PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Rsa1.0_00005.1_g00033.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Brassicales; Brassicaceae; Brassiceae; Raphanus
Family Dof
Protein Properties Length: 207aa    MW: 22582 Da    PI: 9.405
Description Dof family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Rsa1.0_00005.1_g00033.1genomeRGDView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1zf-Dof126.67.8e-402685362
                   zf-Dof  3 ekalkcprCdstntkfCyynnyslsqPryfCkaCrryWtkGGalrnvPvGggrrknkkss 62
                             +++lkcprCds ntkfCyynny+lsqPr+fCk+CrryWtkGGalrnvPvGgg+rkn k+s
  Rsa1.0_00005.1_g00033.1 26 QEELKCPRCDSPNTKFCYYNNYNLSQPRHFCKSCRRYWTKGGALRNVPVGGGTRKNTKRS 85
                             6899****************************************************9876 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
ProDomPD0074782.0E-272177IPR003851Zinc finger, Dof-type
PfamPF027013.1E-332783IPR003851Zinc finger, Dof-type
PROSITE profilePS5088429.4042983IPR003851Zinc finger, Dof-type
PROSITE patternPS0136103167IPR003851Zinc finger, Dof-type
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0044212Molecular Functiontranscription regulatory region DNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 207 aa     Download sequence    Send to blast
MQDPAAYYQS MMAKQQQQQQ PEFPVQEELK CPRCDSPNTK FCYYNNYNLS QPRHFCKSCR  60
RYWTKGGALR NVPVGGGTRK NTKRSTSSSP ASSPSSNSNK KTKNTDPDLS SQTGSRTDTD  120
PTRMLYGFPI GDQDVKGMEM VGGGSFSSLL ASNMQLGLGG IVLDGSGWDP GMGLRRSESG  180
NGGGGGGNPW TDLAMNRVEK EGDDRRK
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankAC1893441e-111AC189344.2 Brassica rapa subsp. pekinensis cultivar Inbred line 'Chiifu' clone KBrB042J11, complete sequence.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_013636419.11e-105PREDICTED: dof zinc finger protein DOF3.1-like
RefseqXP_013672507.11e-105PREDICTED: dof zinc finger protein DOF3.1-like
RefseqXP_013737901.11e-105PREDICTED: dof zinc finger protein DOF3.1-like
SwissprotQ94AR63e-87DOF31_ARATH; Dof zinc finger protein DOF3.1
TrEMBLA0A078JTQ91e-106A0A078JTQ9_BRANA; BnaC01g43680D protein
STRINGscaffold_302540.13e-94(Arabidopsis lyrata)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MalvidsOGEM12692896
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT3G21270.14e-75DOF zinc finger protein 2